General Information

  • ID:  hor000914
  • Uniprot ID:  A0A060YTT7??112-119)
  • Protein name:  CCK-8
  • Gene name:  ccka
  • Organism:  Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)
  • Family:  Gastrin/cholecystokinin family
  • Source:  animal
  • Expression:  brain and pyloric caeca
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oncorhynchus (genus), Salmoninae (subfamily), Salmonidae (family), Salmoniformes (order), Protacanthopterygii, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007586 digestion
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DYLGWMDF
  • Length:  8(112-119)
  • Propeptide:  MNAGICVCVLLAAFSGSSLGRPSHSQDEDKPEPPQLDSVMSPQHTRHTRSAPSSGQLIPFSKPAEDEAEDPRTSLRELLARLISRKGSLQRSSSLSSRASGPGPSHKIKDRDYLGWMDFGRRSAEEYEEYSS
  • Signal peptide:  MNAGICVCVLLAAFSGSSLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A060YTT7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000914_AF2.pdbhor000914_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 117121 Formula: C50H63N9O14S
Absent amino acids: ACEHIKNPQRSTV Common amino acids: D
pI: 3.49 Basic residues: 0
Polar residues: 2 Hydrophobic residues: 3
Hydrophobicity: -13.75 Boman Index: -406
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 4435 Extinction Coefficient cystines: 6990
Absorbance 280nm: 998.57

Literature

  • PubMed ID:  11342099
  • Title:  Identification and Distribution of CCK-related Peptides and mRNAs in the Rainbow Trout, Oncorhynchus Mykiss